Software, Program, Shareware, Freeware download  Software Downloads Home  |  Submit  |  Latest News  |  Category  |  Contact us    

Fleet Maintenance Pro Deluxe 11.0.0.8

Date: 2008-07-11
File Size: 8400
Price: 599.00
Category: Business::Databases & Tools
Platform: Win95,Win98,WinME,WinNT 3.x,WinNT 4.x,Windows2000,WinXP,Windows2003

Fleet Maintenance Pro Deluxe - Makes it easy to manage your fleet maintenance. Track PM, repairs, and costs.



Fleet Maintenance Pro makes it easy to track preventive and repair maintenance on your fleet. Automated and color-coded alerts instantly show you which vehicles and equipment are due for service. Define your own PM schedules and services to track what you need. Track and schedule unexpected repairs or problems and use the history to monitor PM, repairs, parts, labor, and operating costs. Track vendors, fuel, drivers, registrations, and more.


  Fleet Maintenance Pro Deluxe download
[Fleet Maintenance Pro Deluxe screenshot]  [Innovative Maintenance Systems]

Fleet Maintenance Pro Deluxe Related Search:

fleetmaintenancevehicleautoequipmentcartruckmachinerypmrepairlawnservicefuelgasdieselhistorymana

Fleet Maintenance Pro Deluxe Related Titles:

DataMatch 2009 - data quality, cleansing, matching and deduplication software in one easy to use

forSQL Data Generator - An automatic test data generator for large scale database testing and QA

Mexico Postal Code Database (Premium Edition) - Mexican Postal Codes Database Subscription in text, Excel and Access

IP2Location IP-COUNTRY-REGION-CITY Database - IP2Location(tm) IP-COUNTRY-REGION-CITY translates IP address to country, region

Canadian Postal Code Database (Basic Edition) - Canadian Postal Codes Database Subscription in text, Excel, Access and dBASE V

Mexico Postal Code Database (Gold Edition) - Mexican Postal Codes Database Subscription in text, Excel and Access

IP2Location IP-COUNTRY-REGION-CITY-LATITUDE-LONGIT - IP address to country, city, ISP, domain name, latitude, longitude and zip code.

US ZIP Code Database Mixed Case Edition - United States ZIP Codes Database Subscription in text, Excel, Access and dBASE V

Area Code Database (Platinum Edition) - North American area codes NPA/NXX database one month subscription service.

Small Library Organizer Pro - Easily catalog library collections, manage member and circulation data.

AzSQL Decryptor - Decrypt encrypted stored-procedures,triggers,views and user defined functions.

Recovery for Oracle - Recovery for Oracle is a data recovery tool for damaged Oracle databases

DocPoint - Document Management Software - Document and Imaging Management Software

MicroOLAP Database Designer for PostgreSQL - Visual development system for PostgreSQL database design and modeling

MicroOLAP Database Designer for MySQL - Visual development system for MySQL database design, modeling, and creation

Recovery for SQL Server - Recovery for SQL Server recovers corrupted MS SQL Server databases (.MDF/.NDF)


Copyright © 2008 Annesoft Software Downloads, All rights reserved.